
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Cancer
Uniprot NO.:Q9BZM6
Uniprot Entry Name:
Gene Names:ULBP1
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:26-216aa
Sequence:GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG
Protein Description:Full Length of Mature Protein
Tag Info:C-terminal hFc-Myc-tagged
Mol. Weight:52.4 kDa
Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized KLRK1 (CSB-MP012474HU1) at 10 ?g/ml can bind human ULBP1, the EC50 of human ULBP1 protein is 228.5-427.6 ng/ml. ?Human KLRK1 protein Fc tag (CSB-MP012474HU1) captured on COOH chip can bind Human ULBP1 protein Fc/myc tag (CSB-MP887177HU) with an affinity constant of 2.27 nM as detected by LSPR Assay.
Purity:Greater than 93% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:(ALCAN-beta) (NKG2D ligand 1) (N2DL-1) (NKG2DL1) (Retinoic acid early transcript 1I)
Relevance:Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human UL16-binding protein 1(ULBP1),Biotinylated (Active)
- Regular price
- ¥87,300 JPY
- Sale price
- ¥87,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Mucin-16(MUC16),partial (Active)
- Regular price
- ¥61,300 JPY
- Sale price
- ¥61,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Insulin growth factor-like family member 1(IGFL1) (Active)
- Regular price
- ¥80,800 JPY
- Sale price
- ¥80,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Growth hormone receptor(GHR),partial (Active)
- Regular price
- ¥61,300 JPY
- Sale price
- ¥61,300 JPY
- Regular price
-
- Unit price
- per
Sold out