Recombinant Human Ubiquitin-like protein ISG15(Isg15)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Ubiquitin-like protein ISG15(Isg15)

CSB-RP097444h
Regular price
¥80,600 JPY
Sale price
¥80,600 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: P05161

Gene Names: Isg15

Organism: Homo sapiens (Human)

AA Sequence: GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Expression Region: 2-157aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 44.3 kDa

Alternative Name(s): Interferon-induced 15KDA proteinInterferon-induced 17KDA protein ;IP17Ubiquitin cross-reactive protein

Relevance: Ubiquitin-like protein which plays a key role in the innate immune response to viral infection either via its conjugation to a target protein (ISGylation) or via its action as a free or unconjugated protein. ISGylation involves a cascade of enzymatic reactions involving E1, E2, and E3 enzymes which catalyze the conjugation of ISG15 to a lysine residue in the target protein. Its target proteins include SERPINA3G/SPI2A, JAK1, MAPK3/ERK1, PLCG1, TRIM25, STAT5A, MAPK1/ERK2 and globin. Can also isgylate: DDX58/RIG-I which inhibits its function in antiviral signaling response and EIF4E2 which enhances its cap structure-binding activity and translation-inhibition activity. Exhibits antiviral activity towards both DNA and RNA viruses, including influenza A and B virus, sindbis virus (SV) and herpes simplex type-1 (HHV-1). Plays a significant role in the control of neonatal Chikungunya virus (CHIKV) infection by acting as a putative immunomodulator of proinflammatory cytokines. Protects mice against the consequences of Chikungunya virus infection by downregulating the pathogenic cytokine response, often denoted as the cytokine storm. Plays a role in erythroid differentiation. The secreted form of ISG15 can: induce natural killer cell proliferation, act as a chotactic factor for neutrophils and act as a IFN-gamma-inducing cytokine playing an essential role in antimycobacterial immunity

Reference: Identification of a ubiquitin family protein as a novel neutrophil chemotactic factor.Owhashi M., Taoka Y., Ishii K., Nakazawa S., Uemura H., Kambara H.Biochem. Biophys. Res. Commun. 309:533-539(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Ubiquitin-like protein ISG15(Isg15)
    Regular price
    ¥80,600 JPY
    Sale price
    ¥80,600 JPY
    Regular price
    Unit price
    per 
    Sold out
  • ISG15 Antibody - Cat. #: CSB-RA937491A0HU
    Regular price
    ¥62,100 JPY
    Sale price
    ¥62,100 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Bovine Ubiquitin-like protein ISG15(ISG15)
    Regular price
    ¥119,100 JPY
    Sale price
    ¥119,100 JPY
    Regular price
    Unit price
    per 
    Sold out
  • ISG15 Antibody - Cat. #: CSB-PA09744A0Rb
    Regular price
    ¥49,100 JPY
    Sale price
    ¥49,100 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share