Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial (Active)

Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial (Active)

CSB-MP023984HU1
Regular price
¥47,500 JPY
Sale price
¥47,500 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Cancer

Uniprot NO.:Q07011

Uniprot Entry Name:

Gene Names:TNFRSF9

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:24-186aa

Sequence:LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

Protein Description:Partial

Tag Info:C-terminal 10xHis-tagged

Mol. Weight:19.1 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized TNFRSF9 at 2 ?g/mL can bind TNFSF9?CSB-MP023997HU1?, the EC50 is 1.011-2.429 ng/mL.

Purity:Greater than 95% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:(4-1BB ligand receptor) (CDw137) (T-cell antigen 4-1BB homolog) (T-cell antigen ILA) (CD antigen CD137)

Relevance:Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Your list is ready to share