Recombinant Human Tumor necrosis factor receptor superfamily member 5(CD40),partial (Active)

Recombinant Human Tumor necrosis factor receptor superfamily member 5(CD40),partial (Active)

CSB-MP004936HU1
Regular price
¥50,200 JPY
Sale price
¥50,200 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Immunology

Uniprot NO.:P25942

Uniprot Entry Name:

Gene Names:CD40

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:21-193aa

Sequence:EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Protein Description:Partial

Tag Info:C-terminal hFc-tagged

Mol. Weight:48

Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized CD40 at 2 ?g/ml can bind CD40L (CSB-MP004937HU3), the EC50 is 3.112-3.858 ng/ml.?Human CD40 protein hFc tag (CSB-MP004936HU1) captured on COOH chip can bind Human CD40L protein hFc and Flag tag (CSB-MP004937HU3) with an affinity constant of 2.06 nM as detected by LSPR Assay.

Purity:Greater than 92% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:

Relevance:

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

You may also like

  • Recombinant Human Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A),partial (Active)
    Regular price
    ¥59,300 JPY
    Sale price
    ¥59,300 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Tumor necrosis factor receptor superfamily member 1B(TNFRSF1B),partial (Active)
    Regular price
    ¥59,300 JPY
    Sale price
    ¥59,300 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Tumor necrosis factor receptor superfamily member 18(TNFRSF18),partial (Active)
    Regular price
    ¥59,300 JPY
    Sale price
    ¥59,300 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human CD40 ligand(CD40LG),partial (Active)
    Regular price
    ¥90,300 JPY
    Sale price
    ¥90,300 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share