Recombinant Human Tumor-associated calcium signal transducer 2(TACSTD2),partial (Active)

Recombinant Human Tumor-associated calcium signal transducer 2(TACSTD2),partial (Active)

CSB-MP023072HU1
Regular price
¥55,900 JPY
Sale price
¥55,900 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Cancer

Uniprot NO.:P09758

Uniprot Entry Name:

Gene Names:TACSTD2

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:27-274aa

Sequence:HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Protein Description:Partial

Tag Info:C-terminal hFc-tagged

Mol. Weight:56.8 kDa

Biological_Activity:Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6 ng/ml.

Purity:Greater than 90% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:Cell surface glycoprotein Trop-2 (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1) (GA733-1) (M1S1) (TROP2)

Relevance:Cell surface glycoprotein Trop-2 (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1) (GA733-1) (M1S1) (TROP2)

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Your list is ready to share