Recombinant Human Thymic stromal lymphopoietin(TSLP)

Recombinant Human Thymic stromal lymphopoietin(TSLP)

CSB-MP025141HU
Regular price
¥67,400 JPY
Sale price
¥67,400 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug

Updated Date: Stock Protein updated on 20170405

Research areas: Immunology

Target / Protein: TSLP

Biologically active: Not Tested

Expression system: Mammalian cell

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: Q969D9

AA Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Tag info: N-terminal 6xHis-tagged

Expression Region: 29-159aa

Protein length: Full Length

MW: 18.9 kDa

Alternative Name(s):

Relevance: Isoform 1: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c+ dendritic cells. Can induce allergic inflammation by directly activating mast cells. Isoform 2: May act as an antimicrobial peptide in the oral cavity and on the skin.

Reference: "Cloning of human thymic stromal lymphopoietin (TSLP) and signaling mechanisms leading to proliferation."Quentmeier H., Drexler H.G., Fleckenstein D., Zaborski M., Armstrong A., Sims J.E., Lyman S.D.Leukemia 15:1286-1292(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Thymic stromal lymphopoietin(TSLP)
    Regular price
    ¥81,500 JPY
    Sale price
    ¥81,500 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Thymic stromal lymphopoietin protein(TSLP) (Active)
    Regular price
    ¥280,900 JPY
    Sale price
    ¥280,900 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Interleukin-1 alpha(IL1A)
    Regular price
    ¥81,500 JPY
    Sale price
    ¥81,500 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Interleukin-1 alpha(IL1A)
    Regular price
    ¥81,500 JPY
    Sale price
    ¥81,500 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share