
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Biochemicals
Uniprot ID: Q96BY9
Gene Names: SARAF
Organism: Homo sapiens (Human)
AA Sequence: SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR
Expression Region: 195-339aa
Sequence Info: Cytoplasmic Domain
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 31.5 kDa
Alternative Name(s): HBV X-transactivated gene 3 proteinHBV XAg-transactivated protein 3;Protein FOAP-7Transmembrane protein 66
Relevance: Negative regulator of store-operated Ca2+ entry (SOCE) involved in protecting cells from Ca2+ overfilling. In response to cytosolic Ca2+ elevation after endoplasmic reticulum Ca2+ refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity: possibly act by facilitating the deoligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca2+ levels, and thus preventing the overload of the cell with excessive Ca2+ ions.
Reference: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y. , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.DNA Res. 12:117-126(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Store-opeRated calcium entry-associated regulatory factor(SARAF),partial
- Regular price
- ¥90,300 JPY
- Sale price
- ¥90,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Transcriptional enhancer factor TEF-1(TEAD1)
- Regular price
- ¥90,400 JPY
- Sale price
- ¥90,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Transcriptional enhancer factor TEF-5(TEAD3),partial
- Regular price
- ¥80,900 JPY
- Sale price
- ¥80,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Caspase-3(CASP3),partial
- Regular price
- ¥80,900 JPY
- Sale price
- ¥80,900 JPY
- Regular price
-
- Unit price
- per
Sold out