
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Cell Biology
Target / Protein: SEMG1
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P04279
AA Sequence: QKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 24-402aa
Protein length: Full Length of Isoform 2
MW: 58.8 kDa
Alternative Name(s): Cancer/testis antigen 103 Semenogelin I Short name: SGI Cleaved into the following 3 chains: Alpha-inhibin-92 Alpha-inhibin-31 Seminal basic protein
Relevance: Predominant protein in semen. It participates in the formation of a gel matrix entrapping the accessory gland secretions and ejaculated spermatozoa. Fragments of semenogelin and/or fragments of the related proteins may contribute to the activation of progressive sperm movements as the gel-forming proteins are fragmented by KLK3/PSA.
Reference: "Analysis of recombinant human semenogelin as an inhibitor of human sperm motility."Mitra A., Richardson R.T., O'Rand M.G.Biol. Reprod. 82:489-496(2010).
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Semenogelin-1(SEMG1)
- Regular price
- ¥81,500 JPY
- Sale price
- ¥81,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Semenogelin-2(SEMG2)
- Regular price
- ¥118,400 JPY
- Sale price
- ¥118,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Gamma-1-syntrophin(SNTG1)
- Regular price
- ¥92,200 JPY
- Sale price
- ¥92,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Isthmin-1(ISM1)
- Regular price
- ¥109,900 JPY
- Sale price
- ¥109,900 JPY
- Regular price
-
- Unit price
- per
Sold out