Recombinant Human Selenoprotein M(SELM)

Recombinant Human Selenoprotein M(SELM)

CSB-EP837868HUe1
Regular price
¥110,200 JPY
Sale price
¥110,200 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: SELM

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: Q8WWX9

AA Sequence: ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL

Tag info: NO-tagged

Expression Region: 24-145aa

Protein length: Full Length

MW: 13.9 kDa

Alternative Name(s):

Relevance: May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation.

Reference: "Mammalian selenoprotein in which selenocysteine (Sec) incorporation is supported by a new form of Sec insertion sequence element." Korotkov K.V., Novoselov S.V., Hatfield D.L., Gladyshev V.N. Mol. Cell. Biol. 22:1402-1411(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share