Recombinant Human Ras-related protein Rab-5A(RAB5A)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Ras-related protein Rab-5A(RAB5A)

CSB-EP019213HU
Regular price
¥86,000 JPY
Sale price
¥86,000 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Developmental Biology

Uniprot ID: P20339

Gene Names: RAB5A

Organism: Homo sapiens (Human)

AA Sequence: MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN

Expression Region: 1-215aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 39.7 kDa

Alternative Name(s):

Relevance: The small GTPases Rab are key regulators of intracellular mbrane trafficking, from the formation of transport vesicles to their fusion with mbranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to mbranes different sets of downstream effectors directly responsible for vesicle formation, movent, tethering and fusion. RAB5A is required for the fusion of plasma mbranes and early endosomes. Contributes to the regulation of filopodia extension.

Reference: Rab1a and Rab5a preferentially bind to binary lipid compositions with higher stored curvature elastic energy.Kirsten M.L., Baron R.A., Seabra M.C., Ces O.Mol. Membr. Biol. 30:303-314(2013)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share