Recombinant Human Ras-related protein Rab-1A(RAB1A)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Ras-related protein Rab-1A(RAB1A)

CSB-RP003344h
Regular price
¥80,000 JPY
Sale price
¥80,000 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Transport

Uniprot ID: P62820

Gene Names: RAB1A

Organism: Homo sapiens (Human)

AA Sequence: SSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC

Expression Region: 2-205aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 49.5 kDa

Alternative Name(s): YPT1-related protein

Relevance: The small GTPases Rab are key regulators of intracellular mbrane trafficking, from the formation of transport vesicles to their fusion with mbranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to mbranes different sets of downstream effectors directly responsible for vesicle formation, movent, tethering and fusion. RAB1A regulates vesicular protein transport from the endoplasmic reticulum (ER) to the Golgi compartment and on to the cell surface, and plays a role in IL-8 and growth hormone secretion. Regulates the level of CASR present at the cell mbrane. Plays a role in cell adhesion and cell migration, via its role in protein trafficking. Plays a role in autophagosome assbly and cellular defense reactions against pathogenic bacteria. Plays a role in microtubule-dependent protein transport by early endosomes and in anterograde melanosome transport.

Reference: The human Rab genes encode a family of GTP-binding proteins related to yeast YPT1 and SEC4 products involved in secretion.Zahraoui A., Touchot N., Chardin P., Tavitian A.J. Biol. Chem. 264:12394-12401(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Ras-related protein Rab-1A(RAB1A)
    Regular price
    ¥80,000 JPY
    Sale price
    ¥80,000 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Ras-related protein Rab-11A(RAB11A)
    Regular price
    ¥80,000 JPY
    Sale price
    ¥80,000 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Ras-related protein Rab-10(RAB10),partial
    Regular price
    ¥80,000 JPY
    Sale price
    ¥80,000 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Saccharomyces cerevisiae GTP-binding protein YPT1(YPT1)
    Regular price
    ¥120,300 JPY
    Sale price
    ¥120,300 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share