Recombinant Human Pleckstrin homology-like domain family A member 2(PHLDA2)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Pleckstrin homology-like domain family A member 2(PHLDA2)

CSB-EP687493HU
Regular price
¥78,800 JPY
Sale price
¥78,800 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cell Biology

Uniprot ID: Q53GA4

Gene Names: PHLDA2

Organism: Homo sapiens (Human)

AA Sequence: MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP

Expression Region: 1-152aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 44.1 kDa

Alternative Name(s): Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein Imprinted in placenta and liver protein Tumor-suppressing STF cDNA 3 protein Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein p17-Beckwith-Wiedemann region 1 C

Relevance: Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids

Reference: "A 2.5-Mb transcript map of a tumor-suppressing subchromosomal transferable fragment from 11p15.5, and isolation and sequence analysis of three novel genes." Hu R.-J., Lee M.P., Connors T.D., Johnson L.A., Burn T.C., Su K., Landes G.M., Feinberg A.P. Genomics 46:9-17(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share