
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Microbiology
Uniprot NO.:P03129
Uniprot Entry Name:
Gene Names:E7
Species:Human papillomavirus type 16
Source:E.coli
Expression Region:1-98aa
Sequence:MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Protein Description:Full Length
Tag Info:N-terminal 6xHis-tagged and C-terminal 6xHis-tagged
Mol. Weight:16.3 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized HPV16 E7 at 10 ?g/mL can bind Biotinylated MYC?CSB-EP015270HU-B?, the EC50 is 268.1-354.3 ng/mL.
Purity:Greater than 90% as determined by SDS-PAGE.
Endotoxin:Not test.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:Protein E7
Relevance:Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta).
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human Mucin-16(MUC16),partial (Active)
- Regular price
- ¥61,700 JPY
- Sale price
- ¥61,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human papillomavirus type 16 Protein E7(E7)
- Regular price
- ¥80,600 JPY
- Sale price
- ¥80,600 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human papillomavirus type 16 Protein E7(E7)
- Regular price
- ¥80,600 JPY
- Sale price
- ¥80,600 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human papillomavirus type 16 Protein E7(E7)
- Regular price
- ¥80,600 JPY
- Sale price
- ¥80,600 JPY
- Regular price
-
- Unit price
- per
Sold out