Recombinant Human Lymphotoxin-alpha(LTA) (Active)

Recombinant Human Lymphotoxin-alpha(LTA) (Active)

CSB-MP013218HU
Regular price
¥62,000 JPY
Sale price
¥62,000 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Cytokine

Uniprot NO.:P01374

Uniprot Entry Name:

Gene Names:LTA

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:35-205aa

Sequence:LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Protein Description:Full Length of Mature Protein

Tag Info:N-terminal 6xHis-tagged

Mol. Weight:20.8

Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 ?g/ml can bind human TNFRSF1B (CSB-MP023978HU2), the EC50 is 1.632-2.699 ng/ml.?Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 ?g/ml can bind human TNFR1?CSB-MP023977HU1?, the EC50 of human LTA protein is 4.409-6.797 ng/ml.

Purity:Greater than 95% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:

Relevance:

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

You may also like

  • Recombinant Human Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A),partial (Active)
    Regular price
    ¥59,300 JPY
    Sale price
    ¥59,300 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Lymphotoxin-alpha protein(LTA) (Active)
    Regular price
    ¥166,900 JPY
    Sale price
    ¥166,900 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Tumor necrosis factor ligand superfamily member 13B(TNFSF13B),partial,Biotinylated (Active)
    Regular price
    ¥79,100 JPY
    Sale price
    ¥79,100 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Secreted and transmembrane protein 1(SECTM1),partial (Active)
    Regular price
    ¥59,300 JPY
    Sale price
    ¥59,300 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share