Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 4(LGR4),partial

Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 4(LGR4),partial

CSB-BP883618HU
Regular price
¥230,800 JPY
Sale price
¥230,800 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Signal Transduction

Uniprot ID:Q9BXB1

Gene Names:LGR4

Organism:Homo sapiens (Human)

AA Sequence:APPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLT

Expression Region:25-544aa

Sequence Info:Partial

Source:Baculovirus

Tag Info:C-terminal 6xHis-tagged

MW:62.8 kDa

Alternative Name(s):Leucine-rich repeat-containing G-protein coupled receptor 4(G-protein coupled receptor 48)

Relevance:Receptor for R-spondins that potentiates the canonical Wnt signaling pathway and is involved in the formation of various organs. Upon binding to R-spondins (RSPO1, RSPO2, RSPO3 or RSPO4), associates with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. In contrast to classical G-protein coupled receptors, does not activate heterotrimeric G-proteins to transduce the signal. Its function as activator of the Wnt signaling pathway is required for the development of various organs, including liver, kidney, intestine, bone, reproductive tract and eye. May also act as a receptor for norrin (NDP), such results however require additional confirmation in vivo. Required during spermatogenesis to activate the Wnt signaling pathway in peritubular myoid cells. Required for the maintenance of intestinal stem cells and Paneth cell differentiation in postnatal intestinal crypts. Acts as a regulator of bone formation and remodeling. Involved in kidney development; required for maintaining the ureteric bud in an undifferentiated state. Involved in the development of the anterior segment of the eye. Required during erythropoiesis. Also acts as a negative regulator of innate immunity by inhibiting TLR2/TLR4 associated pattern-recognition and proinflammatory cytokine production. Plays an important role in regulating the circadian rhythms of plasma lipids, partially through regulating the rhythmic expression of MTTP (By similarity).

Reference:"Structural basis for R-spondin recognition by LGR4/5/6 receptors." Wang D., Huang B., Zhang S., Yu X., Wu W., Wang X. Genes Dev. 27:1339-1344(2013)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:28-38 business days

You may also like

  • Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 6(LGR6),partial
    Regular price
    ¥76,200 JPY
    Sale price
    ¥76,200 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 5(LGR5),partial
    Regular price
    ¥90,500 JPY
    Sale price
    ¥90,500 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 5(LGR5),partial
    Regular price
    ¥81,000 JPY
    Sale price
    ¥81,000 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Toll-like receptor 4(TLR4),partial
    Regular price
    ¥82,700 JPY
    Sale price
    ¥82,700 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share