Recombinant Human L-lactate dehydrogenase C chain(LDHC)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human L-lactate dehydrogenase C chain(LDHC)

CSB-EP012844HU
Regular price
¥103,100 JPY
Sale price
¥103,100 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cancer

Uniprot ID: P07864

Gene Names: LDHC

Organism: Homo sapiens (Human)

AA Sequence: STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF

Expression Region: 2-332aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 52.2 kDa

Alternative Name(s): Cancer/testis antigen 32 Short name: CT32 LDH testis subunit LDH-X

Relevance: Possible role in sperm motility. (S)-lactate + NAD+ = pyruvate + NADH.

Reference: "Epitopes of human testis-specific lactate dehydrogenase deduced from a cDNA sequence."Millan J.L., Driscoll C.E., Goldberg E.Proc. Natl. Acad. Sci. U.S.A. 84:5311-5315(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human L-lactate dehydrogenase C chain (LDHC) ,partial
    Regular price
    ¥66,600 JPY
    Sale price
    ¥66,600 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial
    Regular price
    ¥103,800 JPY
    Sale price
    ¥103,800 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial
    Regular price
    ¥115,600 JPY
    Sale price
    ¥115,600 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial
    Regular price
    ¥103,700 JPY
    Sale price
    ¥103,700 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share