Recombinant Human Insulin growth factor-like family member 1(IGFL1) (Active)

Recombinant Human Insulin growth factor-like family member 1(IGFL1) (Active)

CSB-MP764932HU
Regular price
¥81,900 JPY
Sale price
¥81,900 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:other

Uniprot NO.:Q6UW32

Uniprot Entry Name:

Gene Names:IGFL1

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:25-110aa

Sequence:APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS

Protein Description:Full Length of Mature Protein

Tag Info:C-terminal hFc-tagged

Mol. Weight:38.7 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 (CSB-MP862025HU) at 2 ?g/mL can bind Human IGFL1, the EC50 is 32.33-47.52 ng/mL.

Purity:Greater than 95% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:

Relevance:Probable ligand of the IGFLR1 cell membrane receptor.

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

You may also like

  • Recombinant Human Insulin-like growth factor II protein(IGF2) (Active)
    Regular price
    ¥85,500 JPY
    Sale price
    ¥85,500 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Insulin-like growth factor I protein(IGF1) (Active)
    Regular price
    ¥29,800 JPY
    Sale price
    ¥29,800 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Secreted and transmembrane protein 1(SECTM1),partial (Active)
    Regular price
    ¥59,500 JPY
    Sale price
    ¥59,500 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human UL16-binding protein 1(ULBP1),Biotinylated (Active)
    Regular price
    ¥88,400 JPY
    Sale price
    ¥88,400 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share