Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial (Active)

Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial (Active)

CSB-MP020067HU1d7
Regular price
¥76,100 JPY
Sale price
¥76,100 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Neuroscience

Uniprot NO.:Q01973

Uniprot Entry Name:

Gene Names:ROR1

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:30-403aa

Sequence:QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Protein Description:Partial

Tag Info:C-terminal 10xHis-tagged

Mol. Weight:44.8 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized ROR1 at 2 ?g/mL can bind anti-ROR1 antibody?CSB-RA020067A1HU?, the EC50 is 0.2450-0.3416 ng/mL.

Purity:Greater than 95% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:(Neurotrophic tyrosine kinase, receptor-related 1)

Relevance:Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo (PubMed:25029443). Receptor for ligand WNT5A which activate downstream NFkB signaling pathway and may result in the inhibition of WNT3A-mediated signaling (PubMed:25029443, PubMed:27162350). In inner ear, crucial for spiral ganglion neurons to innervate auditory hair cells (PubMed:27162350).

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

You may also like

  • Recombinant Human Cytokine receptor common subunit beta(CSF2RB),partial (Active)
    Regular price
    ¥50,900 JPY
    Sale price
    ¥50,900 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human CCN family member 1(CCN1)(Active)
    Regular price
    ¥215,400 JPY
    Sale price
    ¥215,400 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Tumor necrosis factor receptor superfamily member 8(TNFRSF8),partial (Active)
    Regular price
    ¥53,600 JPY
    Sale price
    ¥53,600 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial
    Regular price
    ¥82,000 JPY
    Sale price
    ¥82,000 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share