
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Neuroscience
Target / Protein: QPCT
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: Q16769
AA Sequence: VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 29-361aa
Protein length: Full Length
MW: 53.9 kDa
Alternative Name(s): Glutaminyl cyclase ;QC ;sQCGlutaminyl-tRNA cyclotransferaseGlutamyl cyclase ;EC
Relevance: Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-beta-amyloid. May be involved in the N-terminal pyroglutamate formation of several amyloid-related plaque-forming peptides.
Reference: Structures of human Golgi-resident glutaminyl cyclase and its complexes with inhibitors reveal a large loop movement upon inhibitor binding.Huang K.F., Liaw S.S., Huang W.L., Chia C.Y., Lo Y.C., Chen Y.L., Wang A.H.J. Biol. Chem. 286:12439-12449(2011)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Glutaminyl-peptide cyclotransferase(QPCT)
- Regular price
- ¥81,500 JPY
- Sale price
- ¥81,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Glutaminyl-peptide cyclotransferase(Qpct)
- Regular price
- ¥72,000 JPY
- Sale price
- ¥72,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Glutaminyl-peptide cyclotransferase(Qpct)
- Regular price
- ¥103,900 JPY
- Sale price
- ¥103,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
QPCT Antibody, FITC conjugated - Cat. #: CSB-PA019135LC01HU
- Regular price
- ¥49,600 JPY
- Sale price
- ¥49,600 JPY
- Regular price
-
- Unit price
- per
Sold out