Recombinant Human Glucagon receptor(GCGR),partial (Active)

Recombinant Human Glucagon receptor(GCGR),partial (Active)

CSB-MP009316HU1
Regular price
¥81,700 JPY
Sale price
¥81,700 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Cancer

Uniprot NO.:P47871

Uniprot Entry Name:

Gene Names:GCGR

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:26-136aa

Sequence:AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK

Protein Description:Partial

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

Mol. Weight:18.1 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 ?g/mL can bind Anti-GCGR recombinant antibody (CSB-RA009316A1HU), the EC50 is 3.747-6.666 ng/mL.

Purity:Greater than 95% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:(GL-R)

Relevance:G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system.

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

You may also like

  • Recombinant Human Growth hormone receptor(GHR),partial (Active)
    Regular price
    ¥62,000 JPY
    Sale price
    ¥62,000 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Glucagon receptor(GCGR),partial
    Regular price
    ¥230,500 JPY
    Sale price
    ¥230,500 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Basigin(BSG),partial (Active)
    Regular price
    ¥62,000 JPY
    Sale price
    ¥62,000 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Growth hormone receptor(GHR),partial,Biotinylated (Active)
    Regular price
    ¥88,200 JPY
    Sale price
    ¥88,200 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share