
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Cancer
Uniprot NO.:P52803
Uniprot Entry Name:
Gene Names:EFNA5
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:21-203aa
Sequence:QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
Protein Description:Full Length of Mature Protein
Tag Info:C-terminal hFc-tagged
Mol. Weight:50.1 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized EPHA3(CSB-MP007723HU) at 2 ?g/ml can bind human EFNA5, the EC50 of human EFNA5 protein is 0.8674-1.119 ng/ml.
Purity:Greater than 93% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:AL-1 (EPH-related receptor tyrosine kinase ligand 7) (LERK-7)
Relevance:Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase. Activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization. With the receptor EPHA2 may regulate lens fiber cells shape and interactions and be important for lens transparency maintenance. May function actively to stimulate axon fasciculation. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion.
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human Epigen protein(EPGN) (Active)
- Regular price
- ¥166,900 JPY
- Sale price
- ¥166,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Ephrin type-A receptor 3(EPHA3),partial (Active)
- Regular price
- ¥52,800 JPY
- Sale price
- ¥52,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Secreted and transmembrane protein 1(SECTM1),partial (Active)
- Regular price
- ¥59,300 JPY
- Sale price
- ¥59,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human C-C motif chemokine 4-like protein(CCL4) (Active)
- Regular price
- ¥166,900 JPY
- Sale price
- ¥166,900 JPY
- Regular price
-
- Unit price
- per
Sold out