Size: 10ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 15-20 working days
Research Topic: Signal Transduction
Uniprot ID: P25101
Gene Names: EDNRA
Organism: Homo sapiens (Human)
AA Sequence: MASMTGGQQMGRGSDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGHNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPVHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKDHDQNNHNTDRSSHKDSMN
Expression Region: 21–427aa
Sequence Info: Full Length
Source: in vitro E.coli expression system
Tag Info: C-terminal 10xHis-tagged
MW: 49.9 kDa
Alternative Name(s): Endothelin A receptor
Relevance: Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.
Reference: "Molecular cloning of human endothelin receptors and their expression in vascular endothelial cells and smooth muscle cells."Arai H., Nakao K., Hosoda K., Ogawa Y., Nakagawa O., Komatsu Y., Imura H.Jpn. Circ. J. 56:1303-1307(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.