Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial(COX4I1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial(COX4I1)

CSB-EP005832HU
Regular price
¥85,900 JPY
Sale price
¥85,900 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Metabolism

Uniprot ID: P13073

Gene Names: COX4I1

Organism: Homo sapiens (Human)

AA Sequence: AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

Expression Region: 23-169aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 33.2 kDa

Alternative Name(s): Cytochrome c oxidase polypeptide IVCytochrome c oxidase subunit IV isoform 1 ;COX IV-1

Relevance: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Reference: Isolation of a cDNA clone encoding subunit IV of human cytochrome c oxidase.Zeviani M., Nakagawa M., Herbert J., Lomax M.I., Grossman L.I., Sherbany A.A., Miranda A.F., Dimauro S., Schon E.A.Gene 55:205-217(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share