Recombinant Human CD48 antigen(CD48) (Active)

Recombinant Human CD48 antigen(CD48) (Active)

CSB-MP004941HU
Regular price
¥62,000 JPY
Sale price
¥62,000 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Cancer

Uniprot NO.:P09326

Uniprot Entry Name:

Gene Names:CD48

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:27-220aa

Sequence:QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS

Protein Description:Full Length of Mature Protein

Tag Info:C-terminal hFc-tagged

Mol. Weight:51.3 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized CD48 at 2 ?g/ml can bind Anti-CD48 rabbit monoclonal antibody, the EC50 of human CD48 protein is 0.5806-0.8463 ng/ml.

Purity:Greater than 95% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:B-lymphocyte activation marker BLAST-1 (BCM1 surface antigen) (Leukocyte antigen MEM-102) (SLAM family member 2) (SLAMF2) (Signaling lymphocytic activation molecule 2) (TCT.1) (CD48) (BCM1) (BLAST1)

Relevance:Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation.

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

You may also like

  • Recombinant Human CD44 antigen(CD44),partial (Active)
    Regular price
    ¥62,000 JPY
    Sale price
    ¥62,000 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human CD44 antigen(CD44),partial,Biotinylated (Active)
    Regular price
    ¥88,200 JPY
    Sale price
    ¥88,200 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Basigin(BSG),partial (Active)
    Regular price
    ¥62,000 JPY
    Sale price
    ¥62,000 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Membrane cofactor protein(CD46) (Active)
    Regular price
    ¥59,300 JPY
    Sale price
    ¥59,300 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share