Recombinant Human Cathepsin O(CTSO)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Cathepsin O(CTSO)

CSB-MP006203HU
Regular price
¥69,500 JPY
Sale price
¥69,500 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-25 working days

Research Topic: Cell Biology

Uniprot ID: P43234

Gene Names: CTSO

Organism: Homo sapiens (Human)

AA Sequence: LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV

Expression Region: 108-321aa

Sequence Info: Full Length of Mature Protein

Source: Mammalian cell

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 28.5 kDa

Alternative Name(s): CTSO1

Relevance: Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover.

Reference: "First genome-wide association scan on neurophysiological endophenotypes points to trans-regulation effects on SLC2A3 in dyslexic children." Roeske D., Ludwig K.U., Neuhoff N., Becker J., Bartling J., Bruder J., Brockschmidt F.F., Warnke A., Remschmidt H., Hoffmann P., Muller-Myhsok B., Nothen M.M., Schulte-Korne G. Mol. Psychiatry 16:97-107(2011)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share