Recombinant Human C-X-C motif chemokine 13 protein(CXCL13),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human C-X-C motif chemokine 13 protein(CXCL13),partial

CSB-RP061394h
Regular price
¥85,500 JPY
Sale price
¥85,500 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: O43927

Gene Names: CXCL13

Organism: Homo sapiens (Human)

AA Sequence: VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRS

Expression Region: 23-95aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 12.8 kDa

Alternative Name(s): AngieB cell-attracting chemokine 1 ;BCA-1B lymphocyte chemoattractantCXC chemokine BLCSmall-inducible cytokine B13

Relevance: Chotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.

Reference: A B-cell-homing chemokine made in lymphoid follicles activates Burkitt's lymphoma receptor-1.Gunn M.D., Ngo V.N., Ansel K.M., Ekland E.H., Cyster J.G., Williams L.T.Nature 391:799-803(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share