Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Signal Transduction
Uniprot NO.:Q9UMR2
Uniprot Entry Name:
Gene Names:DDX19B
Species:Homo sapiens (Human)
Source:E.coli
Expression Region:2-479aa
Sequence:ATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN
Protein Description:Full Length of Mature Protein
Tag Info:N-terminal GST-tagged
Mol. Weight:80.8 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized LCN2 at 2 ?g/ml can bind human DDX19B, the EC50 of human DDX19B protein is 17.71-23.15 ?g/ml.
Purity:Greater than 85% as determined by SDS-PAGE.
Endotoxin:Not test.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:DEAD box RNA helicase DEAD5 DEAD box protein 19B DBP5, DDX19, TDBP
Relevance:ATP-dependent RNA helicase involved in mRNA export from the nucleus. Rather than unwinding RNA duplexes, DDX19B functions as a remodeler of ribonucleoprotein particles, whereby proteins bound to nuclear mRNA are dissociated and replaced by cytoplasmic mRNA binding proteins.
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link: