
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Transport
Target / Protein: AQP4
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P55087
AA Sequence: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 253-323aa
Protein length: Cytoplasmic Domain
MW: 24 kDa
Alternative Name(s): Mercurial-insensitive water channel ;MIWCWCH4
Relevance: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous syst.
Reference: Megalencephalic leukoencephalopathy with subcortical cysts protein 1 functionally cooperates with the TRPV4 cation channel to activate the response of astrocytes to osmotic stress dysregulation by pathological mutations.Lanciotti A., Brignone M.S., Molinari P., Visentin S., De Nuccio C., Macchia G., Aiello C., Bertini E., Aloisi F., Petrucci T.C., Ambrosini E.Hum. Mol. Genet. 21:2166-2180(2012)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Aquaporin-4(AQP4),partial
- Regular price
- ¥80,200 JPY
- Sale price
- ¥80,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Aquaporin-4(AQP4),partial
- Regular price
- ¥116,400 JPY
- Sale price
- ¥116,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Aquaporin-4 (Aqp4),partial
- Regular price
- ¥102,200 JPY
- Sale price
- ¥102,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
RecombinantMouseAquaporin-4(Aqp4),partial
- Regular price
- ¥102,200 JPY
- Sale price
- ¥102,200 JPY
- Regular price
-
- Unit price
- per
Sold out