Recombinant Human Apolipoprotein C-I(APOC1)

Recombinant Human Apolipoprotein C-I(APOC1)

CSB-EP001930HUb0
Regular price
¥87,900 JPY
Sale price
¥87,900 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cardiovascular

Uniprot ID:P02654

Gene Names:APOC1

Organism:Homo sapiens (Human)

AA Sequence:TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS

Expression Region:27-83aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:N-terminal 10xHis-tagged

MW:12.7 kDa

Alternative Name(s):Apolipoprotein C1 (Apo-CI) (ApoC-I)

Relevance:Inhibitor of lipoprotein binding to the low density lipoprotein receptor, LDL receptor-related protein, and very low density lipoprotein receptor. Associates with high density lipoproteins and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein. Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.

Reference:"Isolation and characterisation of a cDNA clone for human apolipoprotein CI and assignment of the gene to chromosome 19." Tata F., Henry I., Markham A.F., Wallis S.C., Weil D., Grzeschik K.H., Junien C., Williamson R., Humphries S.E. Hum. Genet. 69:345-349(1985)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.

Involvement in disease:

Subcellular Location:Secreted

Protein Families:Apolipoprotein C1 family

Tissue Specificity:Synthesized mainly in liver and to a minor degree in intestine. Also found in the lung and spleen.

Paythway:Cholesterolmetabolism

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:607

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=110675

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:341

STRING Database Link:https://string-db.org/network/9606.ENSP00000252491

OMIM Database Link:https://www.omim.org/entry/107710107710107710

Lead Time Guidance:13-23 business days

Your list is ready to share