Recombinant Human 28S ribosomal protein S6, mitochondrial(MRPS6)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human 28S ribosomal protein S6, mitochondrial(MRPS6)

CSB-EP014937HU
Regular price
¥100,700 JPY
Sale price
¥100,700 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P82932

Gene Names: MRPS6

Organism: Homo sapiens (Human)

AA Sequence: PRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK

Expression Region: 1-125aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 41.1 kDa

Alternative Name(s):

Relevance:

Reference: "Nineteen additional unpredicted transcripts from human chromosome 21." Reymond A., Camargo A.A., Deutsch S., Stevenson B.J., Parmigiani R.B., Ucla C., Bettoni F., Rossier C., Lyle R., Guipponi M., de Souza S., Iseli C., Jongeneel C.V., Bucher P., Simpson A.J.G., Antonarakis S.E. Genomics 79:824-832(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share