Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Helicobacter pylori (strain J99) (Campylobacter pylori J99)
Uniprot NO.:P64652
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQKEQEAQEIAKKAVKIVFFLGLVVVLLMMINLYMLINQINASAQMSHQIKKIEERLNQE QK
Protein Names:Recommended name: Uncharacterized protein jhp_0078
Gene Names:Ordered Locus Names:jhp_0078
Expression Region:1-62
Sequence Info:full length protein