Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Helianthus annuus (Common sunflower)
Uniprot NO.:Q8VY39
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGGGRVAHPVLKGPSVVKELVIGTVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVV VDEE
Protein Names:Recommended name: Cytochrome c oxidase subunit 5C-2 Alternative name(s): Cytochrome c oxidase polypeptide Vc-2
Gene Names:Name:COX5C2
Expression Region:1-64
Sequence Info:full length protein
You may also like
-
Recombinant Helianthus annuus Cytochrome c oxidase subunit 5C-1(COX5C1)
- Regular price
- ¥169,600 JPY
- Sale price
- ¥169,600 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Helianthus annuus Cytochrome c oxidase subunit 3(COX3)
- Regular price
- ¥195,500 JPY
- Sale price
- ¥195,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Helianthus annuus Cytochrome b6-f complex subunit 4(petD)
- Regular price
- ¥182,100 JPY
- Sale price
- ¥182,100 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cytochrome c oxidase subunit 2(COX2)
- Regular price
- ¥194,200 JPY
- Sale price
- ¥194,200 JPY
- Regular price
-
- Unit price
- per
Sold out