Recombinant Glycine max 2S albumin

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Glycine max 2S albumin

CSB-YP324829GGV
Regular price
¥141,000 JPY
Sale price
¥141,000 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: N/A

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Glycine max (Soybean) (Glycine hispida)

Delivery time: 3-7 business days

Uniprot ID: P19594

AA Sequence: SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMENQSEELEEKQKKKMEKELINLATMCRFGPMIQCDLSSDD

Tag info: N-terminal 6xHis-tagged

Expression Region: 22-158aa

Protein length: Full Length

MW: 18.2 kDa

Alternative Name(s):

Relevance: This is a 2S seed storage protein.

Reference: A soybean cDNA encoding a chromatin-binding peptide inhibits mitosis of mammalian cells.Galvez A.F., de Lumen B.O.Nat. Biotechnol. 17:495-500(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share