Recombinant Escherichia coli Type-1 fimbrial protein, A chain(fimA)

Recombinant Escherichia coli Type-1 fimbrial protein, A chain(fimA)

CSB-EP361210ENV
Regular price
¥121,600 JPY
Sale price
¥121,600 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: fimA

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Escherichia coli (strain K12)

Delivery time: 3-7 business days

Uniprot ID: P04128

AA Sequence: AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 24-182aa

Protein length: Full Length of Mature Protein

MW: 31.8 kDa

Alternative Name(s): Type-1A pilin

Relevance: Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs

Reference: "Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes."Burland V.D., Plunkett G. III, Sofia H.J., Daniels D.L., Blattner F.R.Nucleic Acids Res. 23:2105-2119(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share