
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: ompC
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Escherichia coli (strain K12)
Delivery time: 3-7 business days
Uniprot ID: P06996
AA Sequence: AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 22-367aa
Protein length: Full Length
MW: 54.3 kDa
Alternative Name(s): Outer membrane protein 1BPorin OmpC
Relevance: Forms pores that allow passive diffusion of small molecules across the outer mbrane.
Reference: Crystal structure of osmoporin OmpC from E. coli at 2.0 A.Basle A., Rummel G., Storici P., Rosenbusch J.P., Schirmer T.J. Mol. Biol. 362:933-942(2006)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Escherichia coli Outer membrane protein C (ompC)
- Regular price
- ¥104,400 JPY
- Sale price
- ¥104,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Outer membrane protein C(ompC)
- Regular price
- ¥135,500 JPY
- Sale price
- ¥135,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Outer membrane protein C(ompC)
- Regular price
- ¥122,700 JPY
- Sale price
- ¥122,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Outer membrane protein C (ompC)
- Regular price
- ¥122,700 JPY
- Sale price
- ¥122,700 JPY
- Regular price
-
- Unit price
- per
Sold out