Recombinant Escherichia coli O157:H7 Peptide deformylase(def)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Escherichia coli O157:H7 Peptide deformylase(def)

CSB-EP017707EOD
Regular price
¥128,600 JPY
Sale price
¥128,600 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: def

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Escherichia coli O157:H7

Delivery time: 3-7 business days

Uniprot ID: P0A6K5

AA Sequence: SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKARA

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-169aa

Protein length: Full Length of Mature Protein

MW: 35.2 kDa

Alternative Name(s): Polypeptide deformylase

Relevance: Roves the formyl group from the N-terminal Met of newly synthe>Several Other Sizes Are Also Available. Please Inquire. Default Sized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.

Reference: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share