
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Others
Uniprot NO.:P69506
Uniprot Entry Name:
Gene Names:YTFE
Species:Escherichia coli (strain K12)
Source:E.coli
Expression Region:1-220aa
Sequence:MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE
Protein Description:Full Length
Tag Info:N-terminal GST-tagged
Mol. Weight:51.9 kD
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5 ?g/ml can bind E.coli ytfE, the EC50 of E.coli ytfE protein is 197.90-259.70 ?g/ml.
Purity:Greater than 85% as determined by SDS-PAGE.
Endotoxin:Not test.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:Regulator of cell morphogenesis and NO signaling
Relevance:Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions.
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Escherichia coli Colicin-E5(col),partial
- Regular price
- ¥136,500 JPY
- Sale price
- ¥136,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Heat-stable enterotoxin ST-2
- Regular price
- ¥145,000 JPY
- Sale price
- ¥145,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Aquaporin Z (aqpZ) (Active)
- Regular price
- ¥268,900 JPY
- Sale price
- ¥268,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Lactose permease(lacY),partial
- Regular price
- ¥304,300 JPY
- Sale price
- ¥304,300 JPY
- Regular price
-
- Unit price
- per
Sold out