Recombinant Escherichia coli CS6 fimbrial subunit B(cssB)

Recombinant Escherichia coli CS6 fimbrial subunit B(cssB)

CSB-EP347417ENL
Regular price
¥129,000 JPY
Sale price
¥129,000 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: cssB

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Escherichia coli (strain K12)

Delivery time: 3-7 business days

Uniprot ID: P53510

AA Sequence: GNWQYKSLDVNVNIEQNFIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQQIGKLVNVNNPDQNMNYYIRKDSGAGKFMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLTVSFYSN

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 22-167aa

Protein length: Full Length

MW: 31.9 kDa

Alternative Name(s):

Relevance:

Reference: "Crystal structure of enterotoxigenic Escherichia coli colonization factor CS6 reveals a novel type of functional assembly."Roy S.P., Rahman M.M., Yu X.D., Tuittila M., Knight S.D., Zavialov A.V.Mol. Microbiol. 86:1100-1115(2012)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share