Recombinant Escherichia coli Acidic protein msyB(msyB)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Escherichia coli Acidic protein msyB(msyB)

CSB-BP340725ENV
Regular price
¥77,700 JPY
Sale price
¥77,700 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: msyB

Biologically active: Not Tested

Expression system: Baculovirus

Species of origin: Escherichia coli (strain K12)

Delivery time: 3-7 business days

Uniprot ID: P25738

AA Sequence: MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER

Tag info: C-terminal 6xHis-tagged

Expression Region: 1-124aa

Protein length: Full Length

MW: 16.3 kDa

Alternative Name(s):

Relevance: Could participate in the normal pathway of protein export.

Reference: "Multicopy suppression: an approach to understanding intracellular functioning of the protein export system." Ueguchi C., Ito K. J. Bacteriol. 174:1454-1461(1992)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share