Recombinant Dog Interleukin-18(IL18)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Dog Interleukin-18(IL18)

CSB-EP895937DO
Regular price
¥128,500 JPY
Sale price
¥128,500 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: Q9XSR0

Gene Names: IL18

Organism: Canis lupus familiaris (Dog) (Canis familiaris)

AA Sequence: YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIMFTVQNKS

Expression Region: 37-193aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 22 kDa

Alternative Name(s): Interferon gamma-inducing factor ;IFN-gamma-inducing factorInterleukin-1 gamma ;IL-1 gamma

Relevance: Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.

Reference: Cloning, sequencing, and characterization of dog interleukin-18.Argyle D.J., McGillivery C., Nicolson L., Onions D.E.Immunogenetics 49:541-543(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share