Recombinant Dahlia merckii Defensin-like protein 1

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Dahlia merckii Defensin-like protein 1

CSB-EP316614DAE
Regular price
¥120,800 JPY
Sale price
¥120,800 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P0C8Y4

Gene Names: N/A

Organism: Dahlia merckii (Bedding dahlia)

AA Sequence: ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC

Expression Region: 1-50aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

MW: 19.5 kDa

Alternative Name(s): Cysteine-rich antimicrobial protein 1 Defensin AMP1

Relevance: Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes.

Reference: "Fungal membrane responses induced by plant defensins and thionins." Thevissen K., Ghazi A., De Samblanx G.W., Brownlee C., Osborn R.W., Broekaert W.F. J. Biol. Chem. 271:15018-15025(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share