Recombinant Cat Amyloid protein A(SAA1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Cat Amyloid protein A(SAA1),partial

CSB-YP020656CA
Regular price
¥132,500 JPY
Sale price
¥132,500 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P19707

Gene Names: SAA1

Organism: Felis catus (Cat) (Felis silvestris catus)

AA Sequence: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG

Expression Region: 1-90aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 12.1 kDa

Alternative Name(s): Amyloid fibril protein AACurated

Relevance: Major acute phase reactant. Apolipoprotein of the HDL complex.

Reference: Initial sequence and comparative analysis of SAA cat genome.Pontius J.U., Mullikin J.C., Smith D.R., Lindblad-Toh K., Gnerre S., Clamp M., Chang J., Stephens R., Neelam B., Volfovsky N., Schaffer A.A., Agarwala R., Narfstrom K., Murphy W.J., Giger U., Roca A.L., Antunes A., Menotti-Raymond M. , Yuhki N., Pecon-Slattery J., Johnson W.E., Bourque G., Tesler G., O'Brien S.J.Genome Res. 17:1675-1689(2007)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Cat Amyloid protein A(SAA1),partial
    Regular price
    ¥120,800 JPY
    Sale price
    ¥120,800 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Felis catus (Cat) (Felis silvestris catus) Amyloid protein A(SAA1),partial
    Regular price
    ¥120,800 JPY
    Sale price
    ¥120,800 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Horse Serum amyloid A protein(SAA1)
    Regular price
    ¥120,800 JPY
    Sale price
    ¥120,800 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Horse Serum amyloid A(SAA1)
    Regular price
    ¥132,500 JPY
    Sale price
    ¥132,500 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share