Recombinant Bovine Inhibin alpha chain(INHA)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Bovine Inhibin alpha chain(INHA)

CSB-EP011718BO
Regular price
¥129,200 JPY
Sale price
¥129,200 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P07994

Gene Names: INHA

Organism: Bos taurus (Bovine)

AA Sequence: STPPLPWPWSPAALRLLQRPPEEPAAHADCHRAALNISFQELGWDRWIVHPPSFIFYYCHGGCGLSPPQDLPLPVPGVPPTPVQPLSLVPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYEMVPNLLTQHCACI

Expression Region: 227-360aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 30.6 kDa

Alternative Name(s):

Relevance: Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, bryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.

Reference: Inhibin alpha-subunit monomer is present in bovine follicular fluid.Sugino K., Nakamura T., Takio K., Titani K., Miyamoto K., Hasegawa Y., Igarashi M., Sugino H.Biochem. Biophys. Res. Commun. 159:1323-1329(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share