Recombinant Bordetella pertussis Pertactin autotransporter(prn),partial

Recombinant Bordetella pertussis Pertactin autotransporter(prn),partial

CSB-EP321224BUA
Regular price
¥128,300 JPY
Sale price
¥128,300 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: prn

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

Delivery time: 3-7 business days

Uniprot ID: P14283

AA Sequence: ALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGRRFDQKVAGFELGADHAVAVAGGRWHLGGLAGYTRGDRGFTGDGGGHTDSVHVGGYATYIADSGFYLDATLRASRLENDFKVAGSDGYAVKGKYRTHGVGASLEAGRRFTHADGWFLEPQAELAVFRAGGGAYRAANGLRVRDEGGSSVLGRLGLEVGKRIELAGGRQVQPYIKASVLQEFDGAGTVHTNGIAHRTELRGTRAELGLGMAAALGRGHSLYASYEYSKGPKLAMPWTFHAGYRYSW

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 632-910aa

Protein length: Partial

MW: 45.8 kDa

Alternative Name(s): P.93

Relevance: Agglutinogen that binds to eukaryotic cells; a process mediated by the R-G-D sequence. Pertactin may have a role in bacterial adhesion, and thus play a role in virulence. May contribute to the disease state of whooping cough.

Reference: Structure of Bordetella pertussis virulence factor P.69 pertactin.Emsley P., Charles I.G., Fairweather N.F., Isaacs N.W.Nature 381:90-92(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share