Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:O34509
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTSEMQLQAQIDVIEKENKELRRRNEELGQTVECQNKQIVTQNWRLLFFASSWIVYGIVS AIKYLWG
Protein Names:Recommended name: SPBc2 prophage-derived uncharacterized protein yopZ
Gene Names:Name:yopZ Ordered Locus Names:BSU20710
Expression Region:1-67
Sequence Info:full length protein
You may also like
-
Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopE(yopE)
- Regular price
- ¥172,300 JPY
- Sale price
- ¥172,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopI(yopI)
- Regular price
- ¥184,300 JPY
- Sale price
- ¥184,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopH(yopH)
- Regular price
- ¥184,400 JPY
- Sale price
- ¥184,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yomK(yomK)
- Regular price
- ¥180,600 JPY
- Sale price
- ¥180,600 JPY
- Regular price
-
- Unit price
- per
Sold out