>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171018
Research areas: Others
Target / Protein: N/A
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Avena sativa (Oat)
Delivery time: 3-7 business days
Uniprot ID: P86181
AA Sequence: VSSVISSSLFEKMLLHRGFYTYDAFIAAAKSFPAFATTGSTDVRKREVAAFLAQTSHETTGGWPTAPDGPYELGSTSDYFGRGPIQISYNYNYGAAGKAIGVDLLRNPDLVTSDNTVEFKTALWFWMTPQSPKPSSHDVITGRWSPSSTDKAAGRVPGYGVLTNIIDGGVECGKGQESHVADRIGYYKDNLDCYNQKPFA
Tag info: N-terminal 6xHis-tagged
Expression Region: 1-200aa
Protein length: Full Length
MW: 25.7 kDa
Alternative Name(s):
Relevance: This protein functions as a defense against chitin-containing fungal pathogens.
Reference: "Oat (Avena sativa) seed extract as an antifungal food preservative through the catalytic activity of a highly abundant class I chitinase." Sorensen H.P., Madsen L.S., Petersen J., Andersen J.T., Hansen A.M., Beck H.C. Appl. Biochem. Biotechnol. 160:1573-1584(2010)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.