Recombinant Arabidopsis thaliana L-ascorbate peroxidase 2, cytosolic(APX2),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Arabidopsis thaliana L-ascorbate peroxidase 2, cytosolic(APX2),partial

CSB-RP144194DOA
Regular price
¥128,700 JPY
Sale price
¥128,700 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q1PER6

Gene Names: APX2

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLNDKDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLKLSELGFADK

Expression Region: 4-250aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 31.5 kDa

Alternative Name(s): L-ascorbate peroxidase 1b ;APX1b ;AtAPx02

Relevance: Plays a key role in hydrogen peroxide roval.

Reference: Cytosolic ascorbate peroxidase from Arabidopsis thaliana L. is encoded by a small multigene family.Santos M., Gosseau H., Lister C., Foyer C., Creissen G.P., Mullineaux P.M.Planta 198:64-69(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share