Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Uniprot NO.:Q89829
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFFFGIFRCNMDHWTTKRQVYIYLCFSLMTIALICYLIHICCHTKKNVVTNALPSNNMAL IPYTPSNNMALIPYTPSNNTVPPPYTISGSCPQ
Protein Names:Recommended name: Uncharacterized membrane protein KP93L/DP93R
Gene Names:Ordered Locus Names:BA71V-002 ORF Names:KP93L ANDOrdered Locus Names: BA71V-159ORF Names: DP93R
Expression Region:1-93
Sequence Info:full length protein