
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:B7ZS96
Gene Names:ttr
Organism:Xenopus laevis (African clawed frog)
AA Sequence:APPGHASHGEADSKCPLMVKVLDAVRGIPAANLLVNVFRQTESGKWEQITSGKTTELGEIHNLTTDEQFTEGVYKIEFATKAFWGKLGLSPFHEYVDVVFTANDAGHRHYTIAVLLTPYSFSSTAIVSEPHDDL
Expression Region:20-153aa
Sequence Info:Full Length of Mature Protein
Source:Yeast
Tag Info:N-terminal 6xHis-tagged
MW:16.7 kDa
Alternative Name(s):Transthyretin(xTTR)(Prealbumin)
Relevance:Thyroid hormone-binding protein, with a much higher binding affinity for triiodothyronine (T3) than for thyroxine (T4). Probably transports triiodothyronine from the bloodstream to the brain.
Reference:"In vitro and in vivo analysis of the thyroid system-disrupting activities of brominated phenolic and phenol compounds in Xenopus laevis." Kudo Y., Yamauchi K., Fukazawa H., Terao Y. Toxicol. Sci. 92:87-95(2006)
Purity:Greater than 90% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:25-35 business days
You may also like
-
Recombinant Human Transthyretin(TTR) (Active)
- Regular price
- €382,95 EUR
- Sale price
- €382,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Transthyretin(TTR)
- Regular price
- €498,95 EUR
- Sale price
- €498,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Transthyretin(Ttr)
- Regular price
- €638,95 EUR
- Sale price
- €638,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Transthyretin(Ttr)
- Regular price
- €724,95 EUR
- Sale price
- €724,95 EUR
- Regular price
-
- Unit price
- per
Sold out