Recombinant Tyrophagus putrescentiae Mite group 2 allergen Tyr p 2

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Tyrophagus putrescentiae Mite group 2 allergen Tyr p 2

CSB-EP520769TRH
Regular price
€675,95 EUR
Sale price
€675,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: N/A

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Tyrophagus putrescentiae (Mold mite) (Acarus putrescentiae)

Delivery time: 3-7 business days

Uniprot ID: O02380

AA Sequence: GQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDTCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKLLATGEHGVLACGAVNTDVKP

Tag info: N-terminal 6xHis-tagged

Expression Region: 16-141aa

Protein length: Full Length of Mature Protein

MW: 17.3 kDa

Alternative Name(s): Allergen: Typ p 2

Relevance:

Reference: "Cloning and characterisation of a group II allergen from the dust mite Tyrophagus putrescentiae." Eriksson T.L.J., Johansson E., Whitley P., Schmidt M., Elsayed S., van Hage-Hamsten M. Eur. J. Biochem. 251:443-447(1998)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share